Specialists in ghost hunts, ghost tour overnight ghost hunts and psychic nights

1.68 Rating by CuteStat

ultimateparanormalexperience.co.uk is 1 decade 2 years old. It is a domain having co.uk extension. It has a global traffic rank of #15629726 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, ultimateparanormalexperience.co.uk is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 31
Daily Pageviews: 62

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: 37
Bing Indexed Pages: 1

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 62

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 15,629,726
Domain Authority: 1 ON 100

Web Server Information

Hosted IP Address:

46.30.211.62

Hosted Country:

Denmark DK

Location Latitude:

55.6759

Location Longitude:

12.5655

Websites Hosted on Same IP (i.e. 46.30.211.62)

Gary Lam's Domaining Blog

- fifaliga.com

Domaining Blog - Improve your domaining strategy today. Learn how to succeed buying domains and selling domains with expert domainer Gary Lam.

237,036 $ 21,600.00

Home-Phuket Detectives-Save Time-Save Face-Save Money-Save Heart

- phuketdetectives.com

Faster High Speed Internet Broadband

545,366 $ 1,200.00

Strefa Electro | Witamy

- strefaelectro.pl

Strefa Electro - Witamy

1,228,292 $ 480.00

Gadget Boys

- gadgetboys.nl
783,277 $ 960.00

Home | malayalamtube_net

- malayalamtube.net

malayalamtube.net - An extension of malayalamtube.com

854,704 $ 720.00

Domain Information

Domain Registrar: Nimzo 3, LLC
Registration Date: Dec 28, 2011, 12:00 AM 1 decade 2 years 3 months ago
Expiration Date: Dec 28, 2013, 12:00 AM 1 decade 3 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns01.one.com 195.206.121.10 Denmark Denmark
ns02.one.com 185.10.11.10 Denmark Denmark

Similarly Ranked Websites

Catholic, Orthodox, Free | An Online Source for Catholic Catechesis

- saintjeromecenter.com

The Saint Jerome Center for Catechesis (SJCC) is a catechetical website dedicated to providing Catholics and non-Catholics with free material about the Catholic faith. The SJCC is faithful to the Magisterium of the Catholic Church and is committed to defending Catholic orthodoxy in all matters of faith and morals. Watc

15,629,760 $ 8.95

yaptatadiyamankervansaraykahve.net | Isimtescil.net | Ücretsiz yapım a

- yaptatadiyamankervansaraykahve.net
15,629,791 $ 8.95

nanex.exchange - Registered at Namecheap.com

- nanex.exchange
15,629,834 $ 8.95

herranetxecasarural.com - Registered at Namecheap.com

- herranetxecasarural.com
15,629,844 $ 8.95

fullkontor.biz, Parça Kontör, Turkcell, Vodafone, Avea,

- fullkontor.biz

fullkontor.biz, PARÇA KONTÖR DÄ°STRÄ°BÃœTÖRLÃœÄ

15,629,863 $ 8.95